| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00345193-M09 |
| Product name: | LRIT3 monoclonal antibody (M09), clone 3E7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LRIT3. |
| Clone: | 3E7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 345193 |
| Gene name: | LRIT3 |
| Gene alias: | FIGLER4|FLJ44691|MGC120618 |
| Gene description: | leucine-rich repeat, immunoglobulin-like and transmembrane domains 3 |
| Genbank accession: | NM_198506 |
| Immunogen: | LRIT3 (NP_940908, 422 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTRSHRDDSEKLLLCSRSSVESQVTFKSEGSRPEYYC |
| Protein accession: | NP_940908 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.99 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of LRIT3 expression in transfected 293T cell line by LRIT3 monoclonal antibody (M09), clone 3E7. Lane 1: LRIT3 transfected lysate(60.521 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |