No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00342945-M08 |
| Product name: | ZSCAN22 monoclonal antibody (M08), clone 3E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZSCAN22. |
| Clone: | 3E9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 342945 |
| Gene name: | ZSCAN22 |
| Gene alias: | HKR2|MGC126679|MGC138482|ZNF50 |
| Gene description: | zinc finger and SCAN domain containing 22 |
| Genbank accession: | NM_181846 |
| Immunogen: | ZSCAN22 (NP_862829.1, 196 a.a. ~ 294 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KSVTQQIHFKKTSGPYKDVPTDQRGRESGASRNSSSAWPNLTSQEKPPSEDKFDLVDAYGTEPPYTYSGKRSSKCRECRKMFQSASALEAHQKTHSRKT |
| Protein accession: | NP_862829.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | ZSCAN22 monoclonal antibody (M08), clone 3E9. Western Blot analysis of ZSCAN22 expression in HepG2. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |