| Brand: | Abnova |
| Reference: | H00340719-M01 |
| Product name: | NANOS1 monoclonal antibody (M01), clone 5F12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NANOS1. |
| Clone: | 5F12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 340719 |
| Gene name: | NANOS1 |
| Gene alias: | NOS1 |
| Gene description: | nanos homolog 1 (Drosophila) |
| Genbank accession: | NM_199461.2 |
| Immunogen: | NANOS1 (NP_955631.1, 206 a.a. ~ 270 a.a) partial recombinant protein with GST-pstS1 tag. |
| Immunogen sequence/protein sequence: | LLKPELQVCVFCRNNKEAMALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSKV |
| Protein accession: | NP_955631.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.09 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged NANOS1 is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |