Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RAB7B monoclonal antibody (M01), clone 3B3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about RAB7B monoclonal antibody (M01), clone 3B3
| Brand: | Abnova |
| Reference: | H00338382-M01 |
| Product name: | RAB7B monoclonal antibody (M01), clone 3B3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB7B. |
| Clone: | 3B3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 338382 |
| Gene name: | RAB7B |
| Gene alias: | MGC16212|MGC9726|RAB7 |
| Gene description: | RAB7B, member RAS oncogene family |
| Genbank accession: | NM_177403 |
| Immunogen: | RAB7B (NP_796377, 100 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC |
| Protein accession: | NP_796377 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged RAB7B is approximately 0.03ng/ml as a capture antibody. |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | A novel interaction between Rab7b and actomyosin reveals a dual role in intracellular transport and cell migration.Borg M, Bakke O, Progida C J Cell Sci. 2014 Nov 15;127(22):4927-39. doi: 10.1242/jcs.155861. Epub 2014 Sep 12. |