Brand: | Abnova |
Reference: | H00338382-D01P |
Product name: | RAB7B purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human RAB7B protein. |
Gene id: | 338382 |
Gene name: | RAB7B |
Gene alias: | MGC16212|MGC9726|RAB7 |
Gene description: | RAB7B, member RAS oncogene family |
Genbank accession: | BC017092 |
Immunogen: | RAB7B (AAH17092.1, 1 a.a. ~ 199 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC |
Protein accession: | AAH17092.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RAB7B MaxPab rabbit polyclonal antibody. Western Blot analysis of RAB7B expression in human liver. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |