Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RAB7B MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about RAB7B MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00338382-B01 |
| Product name: | RAB7B MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human RAB7B protein. |
| Gene id: | 338382 |
| Gene name: | RAB7B |
| Gene alias: | MGC16212|MGC9726|RAB7 |
| Gene description: | RAB7B, member RAS oncogene family |
| Genbank accession: | BC017092 |
| Immunogen: | RAB7B (AAH17092, 1 a.a. ~ 199 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC |
| Protein accession: | AAH17092 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of RAB7B expression in transfected 293T cell line (H00338382-T01) by RAB7B MaxPab polyclonal antibody. Lane 1: RAB7B transfected lysate(21.89 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Rab7b controls trafficking from endosomes to the TGN.Progida C, Cogli L, Piro F, De Luca A, Bakke O, Bucci C. J Cell Sci. 2010 May 1;123(Pt 9):1480-91. Epub 2010 Apr 7. |