| Brand: | Abnova |
| Reference: | H00338376-M02 |
| Product name: | IFNE monoclonal antibody (M02), clone 2F8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IFNE. |
| Clone: | 2F8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 338376 |
| Gene name: | IFNE |
| Gene alias: | IFN-E|IFNE1|IFNT1|MGC119018|MGC119020|PRO655 |
| Gene description: | interferon, epsilon |
| Genbank accession: | NM_176891 |
| Immunogen: | IFNE (NP_795372, 109 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR |
| Protein accession: | NP_795372 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |