Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IFNE1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about IFNE1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00338376-A01 |
| Product name: | IFNE1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant IFNE1. |
| Gene id: | 338376 |
| Gene name: | IFNE |
| Gene alias: | IFN-E|IFNE1|IFNT1|MGC119018|MGC119020|PRO655 |
| Gene description: | interferon, epsilon |
| Genbank accession: | NM_176891 |
| Immunogen: | IFNE1 (NP_795372, 109 a.a. ~ 208 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR |
| Protein accession: | NP_795372 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | IFN-{epsilon} Mediates TNF-{alpha}-Induced STAT1 Phosphorylation and Induction of Retinoic Acid-Inducible Gene-I in Human Cervical Cancer Cells.Matsumiya T, Prescott SM, Stafforini DM. J Immunol. 2007 Oct 1;179(7):4542-9. |