Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EMR4P monoclonal antibody (M02), clone 1G10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,ELISA,WB-Re |
More info about EMR4P monoclonal antibody (M02), clone 1G10
| Brand: | Abnova |
| Reference: | H00326342-M02 |
| Product name: | EMR4P monoclonal antibody (M02), clone 1G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EMR4P. |
| Clone: | 1G10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 326342 |
| Gene name: | EMR4P |
| Gene alias: | EMR4|FIRE|GPR127|PGR16 |
| Gene description: | egf-like module containing, mucin-like, hormone receptor-like 4 pseudogene |
| Genbank accession: | XM_377506 |
| Immunogen: | EMR4P (XP_377506, 21 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG |
| Protein accession: | XP_377506 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | EMR4P monoclonal antibody (M02), clone 1G10. Western Blot analysis of EMR4P expression in HeLa(Cat # L013V1 ). |
| Applications: | WB-Ce,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |