| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00286053-B01 |
| Product name: | NSMCE2 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human NSMCE2 protein. |
| Gene id: | 286053 |
| Gene name: | NSMCE2 |
| Gene alias: | C8orf36|FLJ32440|MMS21|NSE2 |
| Gene description: | non-SMC element 2, MMS21 homolog (S. cerevisiae) |
| Genbank accession: | NM_173685 |
| Immunogen: | NSMCE2 (NP_775956.1, 1 a.a. ~ 247 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE |
| Protein accession: | NP_775956.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of NSMCE2 expression in transfected 293T cell line (H00286053-T01) by NSMCE2 MaxPab polyclonal antibody. Lane 1: C8orf36 transfected lysate(27.17 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Expulsion of micronuclei containing amplified genes contributes to a decrease in double minute chromosomes from malignant tumor cells.Ji W, Bian Z, Yu Y, Yuan C, Liu Y, Yu L, Li C, Zhu J, Jia X, Guan R, Zhang C, Meng X, Jin Y, Bai J, Yu J, Lee KY, Sun W, Fu S. Int. J. Cancer. doi: 10.1002/ijc.28467 |