| Brand: | Abnova |
| Reference: | H00285671-M05 |
| Product name: | RNF180 monoclonal antibody (M05), clone 1C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF180. |
| Clone: | 1C4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 285671 |
| Gene name: | RNF180 |
| Gene alias: | MGC120326|MGC120328 |
| Gene description: | ring finger protein 180 |
| Genbank accession: | NM_178532 |
| Immunogen: | RNF180 (NP_848627, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKRSKELITKNHSQEETSILRCWKCRKCIASSGCFMEYLENQVIKDKDDSVDAQNICHVWHMNVEALPEWISCLIQKAQWTVGKLNCPFCGARLGGFNFV |
| Protein accession: | NP_848627 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged RNF180 is 3 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |