No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00253782-M02 |
| Product name: | LASS6 monoclonal antibody (M02), clone 6B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LASS6. |
| Clone: | 6B8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 253782 |
| Gene name: | LASS6 |
| Gene alias: | CerS6|MGC129949|MGC129950 |
| Gene description: | LAG1 homolog, ceramide synthase 6 |
| Genbank accession: | NM_203463 |
| Immunogen: | LASS6 (NP_982288, 62 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR |
| Protein accession: | NP_982288 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.44 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | LASS6 monoclonal antibody (M02), clone 6B8 Western Blot analysis of LASS6 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |