No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00253782-M01 |
Product name: | LASS6 monoclonal antibody (M01), clone 5H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LASS6. |
Clone: | 5H7 |
Isotype: | IgG2a Kappa |
Gene id: | 253782 |
Gene name: | LASS6 |
Gene alias: | CerS6|MGC129949|MGC129950 |
Gene description: | LAG1 homolog, ceramide synthase 6 |
Genbank accession: | NM_203463 |
Immunogen: | LASS6 (NP_982288, 62 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR |
Protein accession: | NP_982288 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (33.44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to LASS6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | D,l-threo-1-phenyl-2-decanoylamino-3-morpholino-1-propanol (DL-PDMP) increases endoplasmic reticulum stress, autophagy and apoptosis accompanying ceramide accumulation via ceramide synthase 5 protein expression in A549 cells.Yamane M, Miyazawa K, Moriya S, Abe A, Yamane S. Biochimie. 2011 May 7. [Epub ahead of print] |