View larger

LASS6 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of LASS6 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00253782-A01
Product name:	LASS6 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant LASS6.
Gene id:	253782
Gene name:	LASS6
Gene alias:	CerS6\|MGC129949\|MGC129950
Gene description:	LAG1 homolog, ceramide synthase 6
Genbank accession:	NM_203463
Immunogen:	LASS6 (NP_982288, 62 a.a. ~ 131 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR
Protein accession:	NP_982288
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (33.81 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Antiapoptotic roles of ceramide-synthase-6-generated C16-ceramide via selective regulation of the ATF6/CHOP arm of ER-stress-response pathways.Senkal CE, Ponnusamy S, Bielawski J, Hannun YA, Ogretmen B. FASEB J. 2009 Sep 1. [Epub ahead of print]