| Brand: | Abnova |
| Reference: | H00246778-M01 |
| Product name: | IL27 monoclonal antibody (M01), clone 3F12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IL27. |
| Clone: | 3F12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 246778 |
| Gene name: | IL27 |
| Gene alias: | IL-27|IL-27A|IL27p28|IL30|MGC71873|p28 |
| Gene description: | interleukin 27 |
| Genbank accession: | NM_145659 |
| Immunogen: | IL27 (NP_663634, 177 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP |
| Protein accession: | NP_663634 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IL27 monoclonal antibody (M01), clone 3F12 Western Blot analysis of IL27 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |