| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00246721-M01 |
| Product name: | POLR2J2 monoclonal antibody (M01), clone 1B2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant POLR2J2. |
| Clone: | 1B2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 246721 |
| Gene name: | POLR2J2 |
| Gene alias: | HRPB11B|MGC105050|MGC54043|RPB11b1 |
| Gene description: | polymerase (RNA) II (DNA directed) polypeptide J2 |
| Genbank accession: | NM_032959.3 |
| Immunogen: | POLR2J2 (NP_116581.3, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNAPPAFESFLLFEGEKITINKDTKVPKACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP |
| Protein accession: | NP_116581.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.5 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of POLR2J2 expression in transfected 293T cell line by POLR2J2 monoclonal antibody (M01), clone 1B2. Lane 1: POLR2J2 transfected lysate(12.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |