Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00246100-B01P |
Product name: | CTAG1A purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human CTAG1A protein. |
Gene id: | 246100 |
Gene name: | CTAG1A |
Gene alias: | ESO1|LAGE2A |
Gene description: | cancer/testis antigen 1A |
Genbank accession: | BC160040.1 |
Immunogen: | CTAG1A (AAI60040.1, 1 a.a. ~ 180 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR |
Protein accession: | AAI60040.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CTAG1A expression in transfected 293T cell line (H00246100-T01) by CTAG1A MaxPab polyclonal antibody. Lane 1: CTAG1A transfected lysate(19.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |