No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00245973-M01 |
| Product name: | ATP6V1C2 monoclonal antibody (M01), clone 3D5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP6V1C2. |
| Clone: | 3D5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 245973 |
| Gene name: | ATP6V1C2 |
| Gene alias: | ATP6C2|VMA5 |
| Gene description: | ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 |
| Genbank accession: | NM_144583 |
| Immunogen: | ATP6V1C2 (NP_653184, 188 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYD |
| Protein accession: | NP_653184 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | ATP6V1C2 monoclonal antibody (M01), clone 3D5 Western Blot analysis of ATP6V1C2 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |