Brand: | Abnova |
Reference: | H00221895-D01P |
Product name: | JAZF1 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human JAZF1 protein. |
Gene id: | 221895 |
Gene name: | JAZF1 |
Gene alias: | DKFZp761K2222|TIP27|ZNF802 |
Gene description: | JAZF zinc finger 1 |
Genbank accession: | BC042441.1 |
Immunogen: | JAZF1 (AAH42441.1, 1 a.a. ~ 243 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYGEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ |
Protein accession: | AAH42441.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | JAZF1 MaxPab rabbit polyclonal antibody. Western Blot analysis of JAZF1 expression in HeLa. |
Applications: | WB-Ce,WB-Tr |
Shipping condition: | Dry Ice |