| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00220202-D03P |
| Product name: | ATOH7 purified MaxPab rabbit polyclonal antibody (D03P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ATOH7 protein. |
| Gene id: | 220202 |
| Gene name: | ATOH7 |
| Gene alias: | Math5|bHLHa13 |
| Gene description: | atonal homolog 7 (Drosophila) |
| Genbank accession: | NM_145178.2 |
| Immunogen: | ATOH7 (NP_660161.1, 1 a.a. ~ 152 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT |
| Protein accession: | NP_660161.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of ATOH7 expression in transfected 293T cell line (H00220202-T03) by ATOH7 MaxPab polyclonal antibody. Lane 1: ATOH7 transfected lysate(16.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |