FLJ30707 MaxPab mouse polyclonal antibody (B01) View larger

FLJ30707 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLJ30707 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about FLJ30707 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00220108-B01
Product name: FLJ30707 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human FLJ30707 protein.
Gene id: 220108
Gene name: FAM124A
Gene alias: FLJ30707
Gene description: family with sequence similarity 124A
Genbank accession: BC034497
Immunogen: FLJ30707 (AAH34497, 1 a.a. ~ 288 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDPKAGGGGEEDDCVDSGAETGGSDYSHLSSTSSELSVEEAQDPFLVSIHIIADPGESQPLQEAIDNVLAWIHPDLPLFRVSERRASRRRRKPPKGAQPALAVVLFLQEEYGEEQILQLHRTLQQPPWRHHHTEQVHGRFLPYLPCSQDFFTLAPGTPLWAIRPVHYGKEIVRFTVYCRYDNYADSLRFYQLILRRSPSQKKADFCIFPIFSNLDVDIQFSLKRLPCDQCPVPTDSSVLEFRVRDIGELVPLLPNPCSPISEGRWQTEDHDGNKILLQVLGGRLSLSV
Protein accession: AAH34497
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00220108-B01-13-15-1.jpg
Application image note: Western Blot analysis of FAM124A expression in transfected 293T cell line (H00220108-T01) by FAM124A MaxPab polyclonal antibody.

Lane 1: FLJ30707 transfected lysate(31.68 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FLJ30707 MaxPab mouse polyclonal antibody (B01) now

Add to cart