No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00219970-M03 |
| Product name: | GLYATL2 monoclonal antibody (M03), clone 1C5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant GLYATL2. |
| Clone: | 1C5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 219970 |
| Gene name: | GLYATL2 |
| Gene alias: | BXMAS2-10|GATF-B|MGC24009 |
| Gene description: | glycine-N-acyltransferase-like 2 |
| Genbank accession: | BC016789.1 |
| Immunogen: | GLYATL2 (AAH16789.1, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQKQEMKDDQDHYTNTYHIFTKASDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKKGNFSNMFIDASHAGLVNEHWAFGKNERSLKYIERCLQDFLGFGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQWKCTPKKYC |
| Protein accession: | AAH16789.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (60.7 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | GLYATL2 monoclonal antibody (M03), clone 1C5. Western Blot analysis of GLYATL2 expression in human ovarian cancer. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |