No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00219938-M01 |
Product name: | SPATA19 monoclonal antibody (M01), clone 4A4 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SPATA19. |
Clone: | 4A4 |
Isotype: | IgG2a Kappa |
Gene id: | 219938 |
Gene name: | SPATA19 |
Gene alias: | FLJ25851|SPAS1|spergen1 |
Gene description: | spermatogenesis associated 19 |
Genbank accession: | NM_174927.1 |
Immunogen: | SPATA19 (NP_777587.1, 1 a.a. ~ 167 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MIITTWIVYILARKGVGLPFLPITSSDIDVVESEAVSVLHHWLKKTEEEASRGIKEKLSINHPSQGVREKMSTDSPPTHGQDIHVTRDVVKHHLSKSDLLANQSQEVLEERTRIQFIRWSHTRIFQVPSEMTEDIMRDRIEQVRRSISRLTDVSAQDFSMRPSSSDC |
Protein accession: | NP_777587.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (45.6 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged SPATA19 is 1 ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |