| Product description: | Human MTIF3 full-length ORF ( NP_690876.2, 1 a.a. - 278 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 219402 |
| Gene name: | MTIF3 |
| Gene alias: | IF-3mt|IF3(mt) |
| Gene description: | mitochondrial translational initiation factor 3 |
| Genbank accession: | NM_152912.3 |
| Immunogen sequence/protein sequence: | MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKIKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ |
| Protein accession: | NP_690876.2 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Size: | 2 ug |
| Shipping condition: | Dry Ice |