DHRSX purified MaxPab mouse polyclonal antibody (B01P)

View larger

DHRSX purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Print

Data sheet of DHRSX purified MaxPab mouse polyclonal antibody (B01P)

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human
Clonality	Polyclonal
Host species	Mouse
Applications	WB-Ti,IF,WB-Tr

More info about DHRSX purified MaxPab mouse polyclonal antibody (B01P)

Product description:	Mouse polyclonal antibody raised against a full-length human DHRSX protein.
Gene id:	207063
Gene name:	DHRSX
Gene alias:	CXorf11\|DHRS5X\|DHRS5Y\|DHRSXY\|DHRSY\|SDR46C1
Gene description:	dehydrogenase/reductase (SDR family) X-linked
Genbank accession:	NM_145177.1
Immunogen:	DHRSX (NP_660160.1, 1 a.a. ~ 330 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL
Protein accession:	NP_660160.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Size:	50 ug
Shipping condition:	Dry Ice

Reviews

Be the first to write your review !

Buy DHRSX purified MaxPab mouse polyclonal antibody (B01P) now