Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DHRSX MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Mouse |
| Applications | WB-Ti,IF,WB-Tr |
More info about DHRSX MaxPab mouse polyclonal antibody (B01)
| Product description: | Mouse polyclonal antibody raised against a full-length human DHRSX protein. |
| Gene id: | 207063 |
| Gene name: | DHRSX |
| Gene alias: | CXorf11|DHRS5X|DHRS5Y|DHRSXY|DHRSY|SDR46C1 |
| Gene description: | dehydrogenase/reductase (SDR family) X-linked |
| Genbank accession: | NM_145177.1 |
| Immunogen: | DHRSX (NP_660160.1, 1 a.a. ~ 330 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL |
| Protein accession: | NP_660160.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Size: | 50 uL |
| Shipping condition: | Dry Ice |