Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SENP5 monoclonal antibody (M01), clone 3C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re,WB-Tr |
More info about SENP5 monoclonal antibody (M01), clone 3C2
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SENP5. |
| Clone: | 3C2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 205564 |
| Gene name: | SENP5 |
| Gene alias: | DKFZp564O1016|FLJ42398|MGC27076 |
| Gene description: | SUMO1/sentrin specific peptidase 5 |
| Genbank accession: | NM_152699 |
| Immunogen: | SENP5 (NP_689912, 2 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KKQRKILWRKGIHLAFSEKWNTGFGGFKKFYFHQHLCILKAKLGRPVTWNRQLRHFQGRKKALQIQKTWIKDEHLCAKTKFNVATQNVSTLSSKVKRKDAKHFISSSK |
| Protein accession: | NP_689912 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Size: | 100 ug |
| Shipping condition: | Dry Ice |