Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TUBB monoclonal antibody (M04), clone 3B3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about TUBB monoclonal antibody (M04), clone 3B3
| Brand: | Abnova |
| Reference: | H00203068-M04 |
| Product name: | TUBB monoclonal antibody (M04), clone 3B3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant TUBB. |
| Clone: | 3B3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 203068 |
| Gene name: | TUBB |
| Gene alias: | M40|MGC117247|MGC16435|OK/SW-cl.56|TUBB1|TUBB5 |
| Gene description: | tubulin, beta |
| Genbank accession: | BC019924 |
| Immunogen: | TUBB (AAH19924, 1 a.a. ~ 444 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA |
| Protein accession: | AAH19924 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (74.36 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TUBB monoclonal antibody (M04), clone 3B3. Western Blot analysis of TUBB expression in Y-79 ( Cat # L042V1 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Tubulin Acetylation Alone Does Not Affect Kinesin-1 Velocity and Run Length In Vitro.Walter WJ, Beranek V, Fischermeier E, Diez S. PLoS One. 2012;7(8):e42218. Epub 2012 Aug 1. |