Brand: | Abnova |
Reference: | H00201294-M06 |
Product name: | UNC13D monoclonal antibody (M06), clone 1E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UNC13D. |
Clone: | 1E11 |
Isotype: | IgG2a Kappa |
Gene id: | 201294 |
Gene name: | UNC13D |
Gene alias: | FHL3|HLH3|HPLH3|Munc13-4 |
Gene description: | unc-13 homolog D (C. elegans) |
Genbank accession: | NM_199242 |
Immunogen: | UNC13D (NP_954712.1, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ATLLSHPQQRPPFLRQAIKIRRRRVRDLQDPPPQMAPEIQPPSHHFSPEQRALLYEDALYTVLHRLGHPEPNHVTEASELLRYLQEAFHVEPEEHQQTL |
Protein accession: | NP_954712.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged UNC13D is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |