No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00200734-M01 |
Product name: | SPRED2 monoclonal antibody (M01), clone 6G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SPRED2. |
Clone: | 6G8 |
Isotype: | IgG2a Kappa |
Gene id: | 200734 |
Gene name: | SPRED2 |
Gene alias: | FLJ21897|FLJ31917|MGC163164|Spred-2 |
Gene description: | sprouty-related, EVH1 domain containing 2 |
Genbank accession: | NM_181784 |
Immunogen: | SPRED2 (NP_861449, 120 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EDLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPCRQVSFPDDDEEIVRINP |
Protein accession: | NP_861449 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged SPRED2 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Spred-2 steady-state levels are regulated by phosphorylation and Cbl-mediated ubiquitination.Lock P, I ST, Straffon AF, Schieb H, Hovens CM, Stylli SS. Biochem Biophys Res Commun. 2006 Dec 29;351(4):1018-23. Epub 2006 Nov 3. |