| Brand: | Abnova |
| Reference: | H00200734-A01 |
| Product name: | SPRED2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SPRED2. |
| Gene id: | 200734 |
| Gene name: | SPRED2 |
| Gene alias: | FLJ21897|FLJ31917|MGC163164|Spred-2 |
| Gene description: | sprouty-related, EVH1 domain containing 2 |
| Genbank accession: | NM_181784 |
| Immunogen: | SPRED2 (NP_861449, 120 a.a. ~ 219 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EDLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPCRQVSFPDDDEEIVRINP |
| Protein accession: | NP_861449 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Direct Association of Sprouty-related Protein with an EVH1 Domain (SPRED) 1 or SPRED2 with DYRK1A Modifies Substrate/Kinase Interactions.Li D, Jackson RA, Yusoff P, Guy GR. J Biol Chem. 2010 Nov 12;285(46):35374-85. Epub 2010 Aug 24. |