Brand: | Abnova |
Reference: | H00200350-M04 |
Product name: | FOXD4L1 monoclonal antibody (M04), clone 8A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FOXD4L1. |
Clone: | 8A8 |
Isotype: | IgG2a Kappa |
Gene id: | 200350 |
Gene name: | FOXD4L1 |
Gene alias: | FOXD5|bA395L14.1 |
Gene description: | forkhead box D4-like 1 |
Genbank accession: | NM_012184 |
Immunogen: | FOXD4L1 (NP_036316.1, 285 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EGADLATPGTLPVLQPSLGPQPWEEGKGLASPPGGGCISFSIESIMQGVRGAGTGAAQSLSPTAWSYCPLLQRPSSLSDNFAATAAASGGGLRQRLRSHQ |
Protein accession: | NP_036316.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged FOXD4L1 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |