Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of APOBEC3F polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about APOBEC3F polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00200316-A01 |
| Product name: | APOBEC3F polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant APOBEC3F. |
| Gene id: | 200316 |
| Gene name: | APOBEC3F |
| Gene alias: | ARP8|BK150C2.4.MRNA|KA6|MGC74891 |
| Gene description: | apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F |
| Genbank accession: | NM_145298 |
| Immunogen: | APOBEC3F (NP_660341, 274 a.a. ~ 372 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | YTSWSPCPECAGEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEIL |
| Protein accession: | NP_660341 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | APOBEC3G and APOBEC3F Require an Endogenous Cofactor to Block HIV-1 Replication.Han Y, Wang X, Dang Y, Zheng YH. PLoS Pathog. 2008 Jul 4;4(7):e1000095. |