Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of U2AF1L3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about U2AF1L3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00199746-A01 |
| Product name: | U2AF1L3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant U2AF1L3. |
| Gene id: | 199746 |
| Gene name: | U2AF1L4 |
| Gene alias: | FLJ35525|MGC33901|U2AF1-RS3|U2AF1L3|U2AF1L3V1|U2AF1RS3|U2af26 |
| Gene description: | U2 small nuclear RNA auxiliary factor 1-like 4 |
| Genbank accession: | NM_144987 |
| Immunogen: | U2AF1L3 (NP_659424, 103 a.a. ~ 201 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GNVPEVASATSCICGPFPRTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKPPSLSCPILPRLPGSI |
| Protein accession: | NP_659424 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |