Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of UBR1 monoclonal antibody (M01), clone 2F5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about UBR1 monoclonal antibody (M01), clone 2F5
| Brand: | Abnova |
| Reference: | H00197131-M01 |
| Product name: | UBR1 monoclonal antibody (M01), clone 2F5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant UBR1. |
| Clone: | 2F5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 197131 |
| Gene name: | UBR1 |
| Gene alias: | JBS|MGC142065|MGC142067 |
| Gene description: | ubiquitin protein ligase E3 component n-recognin 1 |
| Genbank accession: | NM_17491 |
| Immunogen: | UBR1 (NP_777576, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG |
| Protein accession: | NP_777576 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | UBR1 monoclonal antibody (M01), clone 2F5 Western Blot analysis of UBR1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Roles of STAT3/SOCS3 pathway in regulation of the visual function and ubiquitin proteasome-dependent degradation of Rhodopsin during retinal inflammation.Ozawa Y, Nakao K, Kurihara T, Shimazaki T, Shimmura S, Ishida S, Yoshimura A, Tsubota K, Okano H. J Biol Chem. 2008 Sep 5;283(36):24561-70. Epub 2008 Jul 9. |