| Brand: | Abnova |
| Reference: | H00196441-M07 |
| Product name: | CCDC131 monoclonal antibody (M07), clone 3A3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CCDC131. |
| Clone: | 3A3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 196441 |
| Gene name: | ZFC3H1 |
| Gene alias: | CCDC131|DKFZp686A0722|KIAA0546|MGC23401|MGC90200|PSRC2 |
| Gene description: | zinc finger, C3H1-type containing |
| Genbank accession: | BC015679 |
| Immunogen: | CCDC131 (AAH15679.1, 1 a.a. ~ 358 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MATADTPAPASSGLSPKEEGELEDGEISDDDNNSQIRSRSSSSSSGGGLLPYPRRRPPHSARGGGSGGGGGSSSSSSSSQQQLRNFSRSRHASERGHLRGPSSYRPKEPFRSHPPSVRMPSSSLSESSPRPSFWERSHLALDRFRFRGRPYRGGSRWSRGRGVGERGGKPGCRPPLGGGAGSGFSSSQSWREPSPPRKSSKSFGRSPSRKQNYSSKNENCVEETFEDLLLKYKQIQLELECINKDEKLALSSKEENVQEDPKTLNFEDQTSTDNVSITKDSSKEVAPEEKTQVKTFQAFELKPLRQKLTLPGDKNRLKKVKDGAKPLSLKSDTTDSSQGIPYRVKEGFTPIPGLKFSA |
| Protein accession: | AAH15679.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (65.12 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ZFC3H1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |