Brand: | Abnova |
Reference: | H00196441-M07 |
Product name: | CCDC131 monoclonal antibody (M07), clone 3A3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CCDC131. |
Clone: | 3A3 |
Isotype: | IgG1 Kappa |
Gene id: | 196441 |
Gene name: | ZFC3H1 |
Gene alias: | CCDC131|DKFZp686A0722|KIAA0546|MGC23401|MGC90200|PSRC2 |
Gene description: | zinc finger, C3H1-type containing |
Genbank accession: | BC015679 |
Immunogen: | CCDC131 (AAH15679.1, 1 a.a. ~ 358 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MATADTPAPASSGLSPKEEGELEDGEISDDDNNSQIRSRSSSSSSGGGLLPYPRRRPPHSARGGGSGGGGGSSSSSSSSQQQLRNFSRSRHASERGHLRGPSSYRPKEPFRSHPPSVRMPSSSLSESSPRPSFWERSHLALDRFRFRGRPYRGGSRWSRGRGVGERGGKPGCRPPLGGGAGSGFSSSQSWREPSPPRKSSKSFGRSPSRKQNYSSKNENCVEETFEDLLLKYKQIQLELECINKDEKLALSSKEENVQEDPKTLNFEDQTSTDNVSITKDSSKEVAPEEKTQVKTFQAFELKPLRQKLTLPGDKNRLKKVKDGAKPLSLKSDTTDSSQGIPYRVKEGFTPIPGLKFSA |
Protein accession: | AAH15679.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (65.12 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to ZFC3H1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |