Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00196441-B01P |
Product name: | CCDC131 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human CCDC131 protein. |
Gene id: | 196441 |
Gene name: | ZFC3H1 |
Gene alias: | CCDC131|DKFZp686A0722|KIAA0546|MGC23401|MGC90200|PSRC2 |
Gene description: | zinc finger, C3H1-type containing |
Genbank accession: | ENST00000308101 |
Immunogen: | CCDC131 (ENSP00000307825, 1 a.a. ~ 358 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MATADTPAPASSGLSPKEEGELEDGEISDDDNNSQIRSRSSSSSSGGGLLPYPRRRPPHSARGGGSGGGGGSSSSSSSSQQQLRNFSRSRHASERGHLRGPSSYRPKEPFRSHPPSVRMPSSSLSESSPRPSFWERSHLALDRFRFRGRPYRGGSRWSRGRGVGERGGKPGCRPPLGGGAGSGFSSSQSWREPSPPRKSSKSFGRSPSRKQNYSSKNENCVEETFEDLLLKYKQIQLELECINKDEKLALSSKEENVQEDPKTLNFEDQTSTDNVSITKDSSKEVAPEEKTQVKTFQAFELKPLRQKLTLPGDKNRLKKVKDGAKPLSLKSDTTDSSQGIPYRVKEGFTPIPGLKFSA |
Protein accession: | ENSP00000307825 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ZFC3H1 expression in transfected 293T cell line (H00196441-T01) by ZFC3H1 MaxPab polyclonal antibody. Lane 1: PSRC2 transfected lysate(39.38 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |