Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00171483-B03 |
Product name: | FAM9B MaxPab mouse polyclonal antibody (B03) |
Product description: | Mouse polyclonal antibody raised against a full-length human FAM9B protein. |
Gene id: | 171483 |
Gene name: | FAM9B |
Gene alias: | FLJ40182 |
Gene description: | family with sequence similarity 9, member B |
Genbank accession: | NM_205849 |
Immunogen: | FAM9B (NP_995321.1, 1 a.a. ~ 186 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAAWGKKHAGKDPVRDECEERNRFTETREEDVTDEHGEREPFAETDEHTGANTKKPEDTAEDLTAKRKRMKMDKTCSKTKNKSKHALRKKQLKRQKRDYIHSLKLLNVLEEYITDEQKEEEEEEGEEEELIRIFQEQQKKWQQYRSVRRERLKEMKLLRDQFVKALEDFEDLCDRVFSDEDSELDN |
Protein accession: | NP_995321.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FAM9B expression in transfected 293T cell line (H00171483-T01) by FAM9B MaxPab polyclonal antibody. Lane 1: FAM9B transfected lysate(20.46 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |