| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
| Brand: | Abnova |
| Reference: | H00171425-B01P |
| Product name: | CLYBL purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CLYBL protein. |
| Gene id: | 171425 |
| Gene name: | CLYBL |
| Gene alias: | CLB|bA134O15.1 |
| Gene description: | citrate lyase beta like |
| Genbank accession: | BC034360.1 |
| Immunogen: | CLYBL (AAH34360.1, 1 a.a. ~ 340 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDILYARQKIVVIAKAFGLQAVDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK |
| Protein accession: | AAH34360.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of CLYBL expression in transfected 293T cell line (H00171425-T01) by CLYBL MaxPab polyclonal antibody. Lane 1: CLYBL transfected lysate(37.4 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | CLYBL is a polymorphic human enzyme with malate synthase and β-methylmalate synthase activity.Strittmatter L, Li Y, Nakatsuka NJ, Calvo SE, Grabarek Z, Mootha VK Hum Mol Genet. 2014 Jan 12. |