Cart 8 Product Products 4 020,18 € (empty)
No products
To be determined Shipping
4 020,18 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 8 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 020,18 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 020,18 €
Data sheet of ASXL1 monoclonal antibody (M05), clone 6E2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about ASXL1 monoclonal antibody (M05), clone 6E2
| Brand: | Abnova |
| Reference: | H00171023-M05 |
| Product name: | ASXL1 monoclonal antibody (M05), clone 6E2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ASXL1. |
| Clone: | 6E2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 171023 |
| Gene name: | ASXL1 |
| Gene alias: | KIAA0978|MGC117280|MGC71111 |
| Gene description: | additional sex combs like 1 (Drosophila) |
| Genbank accession: | BC064984.1 |
| Immunogen: | ASXL1 (AAH64984.1, 1 a.a. ~ 84 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR |
| Protein accession: | AAH64984.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ASXL1 is 0.3 ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Silencing of ASXL1 impairs the granulomonocytic lineage potential of human CD34(+) progenitor cells.Davies C, Yip BH, Fernandez-Mercado M, Woll PS, Agirre X, Prosper F, Jacobsen SE, Wainscoat JS, Pellagatti A, Boultwood J. Br J Haematol. 2013 Jan 8. doi: 10.1111/bjh.12217. |