No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00170850-M01 |
Product name: | KCNG3 monoclonal antibody (M01), clone 5H2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KCNG3. |
Clone: | 5H2 |
Isotype: | IgG2a Kappa |
Gene id: | 170850 |
Gene name: | KCNG3 |
Gene alias: | KV10.1|KV6.3 |
Gene description: | potassium voltage-gated channel, subfamily G, member 3 |
Genbank accession: | NM_133329 |
Immunogen: | KCNG3 (NP_579875, 23 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMS |
Protein accession: | NP_579875 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged KCNG3 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |