| Brand: | Abnova |
| Reference: | H00170850-A01 |
| Product name: | KCNG3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant KCNG3. |
| Gene id: | 170850 |
| Gene name: | KCNG3 |
| Gene alias: | KV10.1|KV6.3 |
| Gene description: | potassium voltage-gated channel, subfamily G, member 3 |
| Genbank accession: | NM_133329 |
| Immunogen: | KCNG3 (NP_579875, 23 a.a. ~ 121 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMS |
| Protein accession: | NP_579875 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | KCNG3 polyclonal antibody (A01). Western Blot analysis of KCNG3 expression in human ovarian cancer. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | De novo expression of Kv6.3 contributes to changes in vascular smooth muscle cell excitability in a hypertensive mice strain.Moreno-Dominguez A, Cidad P, Miguel-Velado E, Lopez-Lopez JR, Perez-Garcia MT. J Physiol. 2009 Feb 1;587(Pt 3):625-40. Epub 2008 Dec 15. |