NUDT10 MaxPab mouse polyclonal antibody (B01) View larger

NUDT10 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUDT10 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about NUDT10 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00170685-B01
Product name: NUDT10 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human NUDT10 protein.
Gene id: 170685
Gene name: NUDT10
Gene alias: APS2|DIPP3a|hDIPP3alpha
Gene description: nudix (nucleoside diphosphate linked moiety X)-type motif 10
Genbank accession: NM_153183.1
Immunogen: NUDT10 (NP_694853.1, 1 a.a. ~ 164 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP
Protein accession: NP_694853.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00170685-B01-13-15-1.jpg
Application image note: Western Blot analysis of NUDT10 expression in transfected 293T cell line (H00170685-T01) by NUDT10 MaxPab polyclonal antibody.

Lane 1: NUDT10 transfected lysate(18.04 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NUDT10 MaxPab mouse polyclonal antibody (B01) now

Add to cart