| Brand: | Abnova |
| Reference: | H00170302-M03 |
| Product name: | ARX monoclonal antibody (M03), clone 1G11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ARX. |
| Clone: | 1G11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 170302 |
| Gene name: | ARX |
| Gene alias: | ISSX|MRX29|MRX32|MRX33|MRX36|MRX38|MRX43|MRX54|MRX76|MRX87|MRXS1|PRTS |
| Gene description: | aristaless related homeobox |
| Genbank accession: | NM_139058 |
| Immunogen: | ARX (NP_620689, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSNQYQEEGCSERPECKSKSPTLLSSYCIDSILGRRSPCKMRLLGAAQSLPAPLTSRADPEKAVQGSPKSSSAPFEAELHLPPKLRRLYGPGGGR |
| Protein accession: | NP_620689 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ARX is approximately 1ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |