No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Brand: | Abnova |
Reference: | H00169436-M03 |
Product name: | C9orf96 monoclonal antibody (M03), clone 2B5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant C9orf96. |
Clone: | 2B5 |
Isotype: | IgG2a Kappa |
Gene id: | 169436 |
Gene name: | C9orf96 |
Gene alias: | MGC43306|RP11-244N20.8 |
Gene description: | chromosome 9 open reading frame 96 |
Genbank accession: | NM_153710 |
Immunogen: | C9orf96 (NP_714921, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLGPGSNRRRPTQGERGPGSPGEPMEKYQVLYQLNPGALGVNLVVEEMETKVKHVIKQVECMDDHYASQALEELMPLLKLRHAHISVYQELFITWNGEI |
Protein accession: | NP_714921 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western blot analysis of C9orf96 over-expressed 293 cell line, cotransfected with C9orf96 Validated Chimera RNAi ( Cat # H00169436-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with C9orf96 monoclonal antibody (M03), clone 2B5 (Cat # H00169436-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |