> >>MGC42105 polyclonal antibody (A01)
MGC42105 polyclonal antibody (A01) View larger

MGC42105 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of MGC42105 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MGC42105 polyclonal antibody (A01)

Brand: Abnova
Reference: H00167359-A01
Product name: MGC42105 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant MGC42105.
Gene id: 167359
Gene name: MGC42105
Gene alias: NIM1
Gene description: serine/threonine-protein kinase NIM1
Genbank accession: NM_153361
Immunogen: MGC42105 (NP_699192, 342 a.a. ~ 435 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: KHLSETSTLKEEENEVKSTLEHLGITEEHIRNNQGRDARSSITGVYRIILHRVQRKKALESVPVMMLPDPKERDLKKGSRVYRGIRHTSKFCSI
Protein accession: NP_699192
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00167359-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MGC42105 polyclonal antibody (A01) now

Add to cart