Brand: | Abnova |
Reference: | H00166979-M11 |
Product name: | CDC20B monoclonal antibody (M11), clone 2F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDC20B. |
Clone: | 2F2 |
Isotype: | IgG1 Kappa |
Gene id: | 166979 |
Gene name: | CDC20B |
Gene alias: | FLJ37927|G6VTS76519 |
Gene description: | cell division cycle 20 homolog B (S. cerevisiae) |
Genbank accession: | NM_152623 |
Immunogen: | CDC20B (NP_689836.2, 416 a.a. ~ 515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VLAIGGGMKDGRLHILDINAGKSIQTPSTNSQICSLIWLPKTKEIATGQGTPKNDVTVWTCPTVSRSGHRGRVLHLALSPDQTRVFSAAADGTASVWNCY |
Protein accession: | NP_689836.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CDC20B is 0.1 ng/ml as a capture antibody. |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |