View larger

MGC26963 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of MGC26963 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00166929-A01
Product name:	MGC26963 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant MGC26963.
Gene id:	166929
Gene name:	SGMS2
Gene alias:	MGC26963\|SMS2
Gene description:	sphingomyelin synthase 2
Genbank accession:	NM_152621
Immunogen:	MGC26963 (NP_689834, 2 a.a. ~ 80 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	DIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESRNKFPLEWWKTG
Protein accession:	NP_689834
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (34.8 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice