| Brand: | Abnova |
| Reference: | H00162466-M10 |
| Product name: | PHOSPHO1 monoclonal antibody (M10), clone 1A11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PHOSPHO1. |
| Clone: | 1A11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 162466 |
| Gene name: | PHOSPHO1 |
| Gene alias: | - |
| Gene description: | phosphatase, orphan 1 |
| Genbank accession: | NM_178500 |
| Immunogen: | PHOSPHO1 (NP_848595, 168 a.a. ~ 266 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFCPMGLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQQVLKS |
| Protein accession: | NP_848595 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | PHOSPHO1 monoclonal antibody (M10), clone 1A11. Western Blot analysis of PHOSPHO1 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |