| Brand: | Abnova |
| Reference: | H00162333-M01 |
| Product name: | RNF190 monoclonal antibody (M01), clone 5E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF190. |
| Clone: | 5E10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 162333 |
| Gene name: | MARCH10 |
| Gene alias: | FLJ35757|MARCH-X|RNF190 |
| Gene description: | membrane-associated ring finger (C3HC4) 10 |
| Genbank accession: | NM_152598 |
| Immunogen: | RNF190 (NP_689811, 76 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DALTEPRSSIKISAFKCDSKLPAIDQTSVKQKHKSTMTVRKAEKVDPSEPSPADQAPMVLLRKRKPNLRRFTVSPESHSPRASGDRSRQKQQWPAKVPVPRGADQVVQQ |
| Protein accession: | NP_689811 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RNF190 monoclonal antibody (M01), clone 5E10 Western Blot analysis of RNF190 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |