No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00162333-M01 |
Product name: | RNF190 monoclonal antibody (M01), clone 5E10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF190. |
Clone: | 5E10 |
Isotype: | IgG1 Kappa |
Gene id: | 162333 |
Gene name: | MARCH10 |
Gene alias: | FLJ35757|MARCH-X|RNF190 |
Gene description: | membrane-associated ring finger (C3HC4) 10 |
Genbank accession: | NM_152598 |
Immunogen: | RNF190 (NP_689811, 76 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DALTEPRSSIKISAFKCDSKLPAIDQTSVKQKHKSTMTVRKAEKVDPSEPSPADQAPMVLLRKRKPNLRRFTVSPESHSPRASGDRSRQKQQWPAKVPVPRGADQVVQQ |
Protein accession: | NP_689811 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | RNF190 monoclonal antibody (M01), clone 5E10 Western Blot analysis of RNF190 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |